PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf07987g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family EIL
Protein Properties Length: 529aa    MW: 58794.8 Da    PI: 5.263
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf07987g00007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3182.93e-56381591125
                               XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpve 85 
                               eel++rmwkd+++lkrlker+k     + +a++++++++ ++qarrkkmsraQDgiLkYMlk mevcna+GfvYgiip+kgkpv+
  Peinf101Scf07987g00007.1  38 EELERRMWKDRIKLKRLKERQKLA---ALQAAEKQNNKQVSDQARRKKMSRAQDGILKYMLKLMEVCNARGFVYGIIPDKGKPVS 119
                               8*******************9964...45558899999*********************************************** PP

                               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3  86 gasdsLraWWkekvefdrngpaaiskyqaknlilsgessl 125
                               gasd++raWWkekv+fd+ngpaai+ky+a++l+ +++   
  Peinf101Scf07987g00007.1 120 GASDNIRAWWKEKVKFDKNGPAAIAKYEAECLAREERPPP 159
                               *****************************99987755444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.5E-5538155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MAVIDDIGVD ISSDIEVDDI RGGDIAEKDV SDEEIEPEEL ERRMWKDRIK LKRLKERQKL  60
AALQAAEKQN NKQVSDQARR KKMSRAQDGI LKYMLKLMEV CNARGFVYGI IPDKGKPVSG  120
ASDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAREERPPPR SRGEKKKPSS STDSDYDVDG  180
VDDGIGSVSS RDERRNQPLD VHPLNAVPPS HQSKEQGNGR YRRRKRARSN PTEQQIQPYL  240
IHGDEHSNTI PDINSSQTLF VGCITNESLL VNDKSEAPKP AENDSESQPE LPLQDSNLSL  300
VPSANVVSIE DAYIGTGPSL NIMSQNSAVV PYESGMHLGS QDSAIQHQFQ DTQFHGCHKI  360
SGRNNGPQSS SLHYGTPNNG LHYGPHSSVV HTELQDSAFV HGSQYSNINQ PRMYHSYSSA  420
EFGSTHEETQ SHLACNELQI RPMNSGVGSS VLNGTGNDII GDDHHYGNDI YQNNHDRQIE  480
MPFPSPLAIG SPDYALGSPF NLGLDIQSHL DSPDYDLDFD KEFMSFFAS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3532480.0AY353248.1 Petunia x hybrida EIL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015164694.11e-180PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLM1BXC80.0M1BXC8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000551021e-180(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-53ETHYLENE-INSENSITIVE3-like 3